SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008700 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008700
Domain Number 1 Region: 919-1058
Classification Level Classification E-value
Superfamily PH domain-like 5.17e-37
Family Phosphotyrosine-binding domain (PTB) 0.0023
Further Details:      
 
Domain Number 2 Region: 46-171
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-32
Family Ankyrin repeat 0.00058
Further Details:      
 
Domain Number 3 Region: 774-837
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.68e-16
Family SAM (sterile alpha motif) domain 0.0031
Further Details:      
 
Domain Number 4 Region: 741-773
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000116
Family SAM (sterile alpha motif) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008700   Gene: ENSDORG00000009254   Transcript: ENSDORT00000009259
Sequence length 1139
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2257:58712:551107:-1 gene:ENSDORG00000009254 transcript:ENSDORT00000009259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDQELLAARTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIWRGPNVNCTDSSGYT
ALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSRV
NEQTEKGSALHEAALFGKVDVVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATL
LQEYLEGVGRSAVLGELVQEDTTQEIHISSPVESPSQKTKSETVTGELSKLLDEIKLCQE
KDYSFEDLCNTISDHYLDNLSKISEEELGKNGSQSVRTSSTINLSPGEVEEDDDDENTCG
PTGLWEALTPCNGCRNLGFPMLAQESYPKKRNYTMEIVPSGSLDTFPPENENFLCDLMDT
AVTKKPCSLEIARAPSPRTDNSSEVAIIAPGTSNHRNSSTGPTPDCSPPSPDTALKNIVK
VIRPQPKQRTSIVSSLDFHRMNHNQEYFEINTATGCINFTSSPPVSPPTSSAETTEGNNE
RPDQREDPSQQEANDPPKEYDPGQFAGLLHGSSPACESPENPFHLYGKREQCEEQDESSL
ASSPLPFKQTAIEKSSEPLVKKIKPKVVSRTIFHKRSNLLENHTIVGTRTTRSGSRSGDQ
WIVNTGGFVERACTLGRIRSLPKALIDMHLSKVSKSDSDLIAYPKEASRVNWSESTAEHS
SKESERTPSFTSEWEEIDKIMNSIDVGINTELEEMNGEATXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHP
TSVAEWLDSIELGDYTKAFLINGYTSMDLLKKIWEVELINVLKISLIGHRKRILASLGDR
LHEDPPQKPPRSITLREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNEN
YFDDIPRSKLERQMAQTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFY
LGSMLIKELRGTESTQDACAKMRVKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHE
IRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPHASLRRWQPSQAYNETHEEFQ
Download sequence
Identical sequences ENSDORP00000008700 ENSDORP00000008700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]