SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008732 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008732
Domain Number 1 Region: 259-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000505
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 216-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000263
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008732   Gene: ENSDORG00000009293   Transcript: ENSDORT00000009293
Sequence length 478
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2190:664:28223:1 gene:ENSDORG00000009293 transcript:ENSDORT00000009293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSDELESKPELLVQFVQNTSIPLGQGLVEAEAKDITCLSLLPVXXXXXXXXXXXXXDTP
SHTNSSKEVTSSAVLRSLQVNVGPDGEETRAHTVQKSPEFLSTPDSPSLLQDLQPSDSTS
FILLNLTRAGLGSSAEHLVFVQDEAEDSGNDFLSNESTDSSIPWFLRVQELAHDSLIAAT
RAQLAKNAKTSSNGENVHHGSGDGQPKDSGPLPQVEKKLKCTVEGCGRTFVWPAHFKYHL
KTHRNDRSFICPAEGCGKSFYVLQRLKVHMRTHNGEKPFMCPESGCGKQFTTAGNLKNHR
RIHTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXEPLMGSSLLEEASVPSKNLVSMNSQSSLGGESLNLPNTNSILG
VDDEVLTEGSPRPLSSVPDVTHHLVTMQSGRQSYEVSVLTAVNPQELLNQGDLTERRT
Download sequence
Identical sequences ENSDORP00000008732 ENSDORP00000008732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]