SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008738 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008738
Domain Number 1 Region: 63-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000119
Family HkH motif-containing C2H2 finger 0.0057
Further Details:      
 
Domain Number 2 Region: 127-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000131
Family HkH motif-containing C2H2 finger 0.017
Further Details:      
 
Domain Number 3 Region: 6-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000278
Family HkH motif-containing C2H2 finger 0.0025
Further Details:      
 
Domain Number 4 Region: 186-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000039
Family Classic zinc finger, C2H2 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008738   Gene: ENSDORG00000009300   Transcript: ENSDORT00000009299
Sequence length 229
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4830:8464:224009:-1 gene:ENSDORG00000009300 transcript:ENSDORT00000009299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRL
RSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTATPL
SSLKQPRVDTAPVVASPYQRRDSDRYCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLE
QLGTTLDMGELRGLRRNYRCTICSVSLNSIEQYHAHLKGSKHQTNLKNK
Download sequence
Identical sequences A0A1S3FVJ7
XP_012880591.1.60039 ENSDORP00000008738 ENSDORP00000008738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]