SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008769 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008769
Domain Number 1 Region: 441-563,591-690
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.02e-51
Family Ankyrin repeat 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008769   Gene: ENSDORG00000009331   Transcript: ENSDORT00000009331
Sequence length 716
Comment pep:novel scaffold:dipOrd1:scaffold_19318:17408:29183:1 gene:ENSDORG00000009331 transcript:ENSDORT00000009331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEDKLMDDGRGGEGMLDAAGDGGLMTSPLNLAYFYGTSPPAAAAPGLSDAGCPSSGPSA
PGSPDSDSSDFSSASSASSCWAVESRPKGCARAECPRTEPHMGVGRQQRGPFQGVRVKNS
VKELLLHIRSHKLKASGQVADDFKTQSVNIGQLTELKNTGLYSGKRKGPDFLSDGPACKR
PAPLHTQFLTPPQTPTPGESMEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXYEPNLFEGQEPQSNQSFVSFLNGLNAENIAIPSQLSPS
VQQQNDAHQNFSLVPNSACEATGAHDAASATSNTSLPFLNMIGNPMNATQLGKSFFQWQV
EQEENKLANISQDQLLSKDADGDTFLHIAVAQGRRALSYVLARKMNALCMLDIKEHNGQS
ALQVAVAANQHLIVQDLVNLGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVRSNQF
VDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQHHSPEVQELLLKNKSLVDTIKCLIQMG
ASVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNTKAYNGNTALHVAASLQYR
VTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
Download sequence
Identical sequences ENSDORP00000008769 ENSDORP00000008769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]