SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008807 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008807
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.09e-25
Family Chaperone J-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 301-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000794
Family Classic zinc finger, C2H2 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008807   Gene: ENSDORG00000009370   Transcript: ENSDORT00000009370
Sequence length 572
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_239:276643:296914:1 gene:ENSDORG00000009370 transcript:ENSDORT00000009370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCHEALGMRRDASEEELKKAYRKLAQKWHPDKNLDNAEEAAEQFKLIQAAYDVLSDPQE
RAWYDNHREALLKGGIDGEYQDDSLDLLHYFTVTCYSGYGDDKKGFYAVYRNVFEMIAKE
EIESVLEEDIQDFPTFGYSHSDYDTVVHPFYAYWQSFCTQKNFAWKEEYDTRQASNRWEK
RAMEKENKKIRDKARKEKNELVRQLVAFIRKRDKRVQAHRKLVEEQNAEKARKAEEMRRQ
QKLKQAKLAEQYREQSWMTMANLEKELQEMEARYEKEFGDGSDENEVEQQETKDTQDGKD
SDEAEEAEFYDDLYCPACDKSFKTEKAMKNHEKSKKHREMVALLKQQLEEEEEQFSKPQA
DEDLLNGSSEEETDNAPKQKLSKKQKKKKHKPTQEIHGKDLFQVVLGKCVFSGYVHGECM
SKHGKLFLRNRWNYDDNYNENGTEEAIKIDPEDTNLNGDSAKEVEGSPQENVSVTETIEP
CVDLKSEAKSVPKLKGKKTKDMKKSIKVPSEPQTVSDVLISCTACHSEFPSRNKLFDHLK
ATGHARAPTSSSSSSLNSVTSSRSKKEKRKIR
Download sequence
Identical sequences ENSDORP00000008807 ENSDORP00000008807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]