SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008824 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008824
Domain Number 1 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 431-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.2e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 372-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 526-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 334-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 247-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 151-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000979
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008824   Gene: ENSDORG00000009396   Transcript: ENSDORT00000009394
Sequence length 587
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5555:6908:62594:-1 gene:ENSDORG00000009396 transcript:ENSDORT00000009394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEPSEAKSQVSVTFEDVAVLFTRDEWRKLDPSQRSLYREVMLENYSNLASLGLPFAKP
KMISVLQGEDLWKVEKEGTGVPSRWKHSHKTTKSTQTPESSFQGLIMKRSKRNGPRNLKL
EKHCIYEDKSEKKKGENTGKGHKNNEFSQKFSPKSLLVRQQIVPREEAPPKCERQANTFK
QNSDLLNPPKLTAEKRYQCSICEKTFINTSSLRKHEKNHSGEKLFKCKECSKAFNQSSAL
IQHQITHTGEKPYICKECGKAFTLSTSLYKHLRTHTVEKSYRCKECGKAFGRRSGLFIHQ
KIHAGENPCRYNPGRKASSCNTSFPGQRIHSRKKSYLCNECGNTFKSSSSLRYHQRIHTG
EKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCTECGKGFTSISRLNRHRIIHTGEKFY
NCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSSALIQHQRMHTGERPYKCNE
CGKTFRCNSSLSNHQRIHTGEKPYRCEECGMSFGQSSALIQHRRIHTGEKPFKCNTCGKT
FRQSSSRIAHQRIHTGEKPYECNTCGKLFNHRSSLTNHYKTHVEEDS
Download sequence
Identical sequences ENSDORP00000008824 ENSDORP00000008824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]