SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008825 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008825
Domain Number 1 Region: 65-131
Classification Level Classification E-value
Superfamily Homeodomain-like 1.33e-25
Family Homeodomain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008825   Gene: ENSDORG00000009397   Transcript: ENSDORT00000009396
Sequence length 226
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5555:20057:23271:-1 gene:ENSDORG00000009397 transcript:ENSDORT00000009396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEDGRREQGKQKKERLYTSIIPERFPAAGMLTPTVERSTQSYRRLPGAGVGKLRLSRQG
GQRAHPLSRRRHRTTFNPAQLEQLESAFGRNQYPDIWAREGLARDTGLSEARIQVWFQNR
RAKQRKQERSLLQPLAHLAPATFSGFLPESPACPYSYPAPPPPVACFTHPYNHPLPSQPP
TGGSFALPHQSEDWYPTLHPTPTGHLSCPPPPPMLPLSLEPPKSWN
Download sequence
Identical sequences A0A1S3GC50
ENSDORP00000008825 XP_012886396.1.60039 ENSDORP00000008825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]