SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008882 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000008882
Domain Number - Region: 18-42
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0012
Family Pyk2-associated protein beta ARF-GAP domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008882   Gene: ENSDORG00000009458   Transcript: ENSDORT00000009457
Sequence length 158
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6459:33711:34288:1 gene:ENSDORG00000009458 transcript:ENSDORT00000009457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMSQGKYTFFTCLAGFWLIWGLIVLLCCFCSFLHRRLKRHQEERLREQHLRALELEPLE
LEGSLAGSPPGLAPPPPPHRGRQEAPPHAHAHPLLHHGPAPAHAHAHPHHHALPHPPPPP
PHLSVPPRPWSYPRQAESDMSKPQCYEEAVLMAEPPPP
Download sequence
Identical sequences ENSDORP00000008882 ENSDORP00000008882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]