SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008897 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008897
Domain Number 1 Region: 32-119
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.97e-36
Family SCAN domain 0.0000499
Further Details:      
 
Domain Number 2 Region: 643-699
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 447-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 586-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.92e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 688-740
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 151-210
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 9 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.25e-17
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 10 Region: 493-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000234
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008897   Gene: ENSDORG00000009473   Transcript: ENSDORT00000009473
Sequence length 747
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3403:10034:24859:-1 gene:ENSDORG00000009473 transcript:ENSDORT00000009473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSQFLLMWKSDKAQSGPHNIEKQALTSRLLHDTEACRQNFRNFPYSDLAGPRKALSQLRE
LCLKWLRPEIHSKEQILELLVLEQFLTILPGEVRTWVKSQYPESSEEVVTLVEDLTQLLE
EEAPQNSVLCQETPEEDPRHAFQAGWFNDLVTKESMTFKDVAVDITQEDWELMRPVQKEL
YKTVTLQNYWNMVSLGLTVYRPTVIPILEEPWMVIKEILEGPSQEWKTEGQACTTVENIP
KFKQDGTQTIKLEESYDYDNSLETYTTYTIGKSHTSERDFSLKSSFFEEEDPTEEYLSKY
DIYRNNFENHSNLIVQFDTQSDNKTFMYNEGKATFSNVSYGIVHGKILPGEKPYKCNRCG
KKFRKYPSLLKHQSTHAKEKSYECEECGKAFRHISSLIAHQRMHTGEKPYECHQCGKAFS
QRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPYKCLECSKTFSHSSS
LINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNECWKVFSQSTYLIRH
QRIHSGEKCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNVCGKAFSQSANLTQHHRTH
TGEKPFKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQGANLTQHQRIHTGEK
PYKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLIQHQRIHTGEKPYAC
RICGKSFTQSTNLIQHQRVHTGAKHRK
Download sequence
Identical sequences ENSDORP00000008897 ENSDORP00000008897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]