SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009006 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009006
Domain Number 1 Region: 97-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 152-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 198-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 4 Region: 49-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000587
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 5 Region: 303-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000795
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 236-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000613
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009006   Gene: ENSDORG00000009584   Transcript: ENSDORT00000009584
Sequence length 366
Comment pep:novel scaffold:dipOrd1:scaffold_45060:205:1581:-1 gene:ENSDORG00000009584 transcript:ENSDORT00000009584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFTKHSIECLSFRRDWKCKSQIERKQGSLDGHFSQMIFPSEDMPTSTQHQRIHTNEKL
LECKEYGKDFVFISVLICHQRIHMGEKRKCKECGKAFGSGANLAYHQRIHTSERPYECKD
CGKAFSFGSGLIRHQILHSGEKTYECKECDKSFSFKSALTPHHRIHTDEKPYQCKDFEKA
FGSGSNLTQHQRVHTGEKPFECKTCGMAFSSGSALTWHQRIHTGKKPYICSECGKAFSFG
SALTRHQRIHSGKKPCKKCGKAFTNGSNQHQRIHRGEKHVCKECKKVFRSGKFIQHQRMH
TTPFDGQVCGKIFSSASDLAQQIHTGEKPYKECGKAFGSNSKLIEHQLIHTGEKPYECCG
KSFFFG
Download sequence
Identical sequences ENSDORP00000009006 ENSDORP00000009006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]