SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009023 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009023
Domain Number 1 Region: 464-547
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.35e-26
Family Forkhead DNA-binding domain 0.0000198
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009023
Domain Number - Region: 307-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0292
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009023   Gene: ENSDORG00000009604   Transcript: ENSDORT00000009603
Sequence length 677
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6496:48462:290417:-1 gene:ENSDORG00000009604 transcript:ENSDORT00000009603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQESGTETKSNGSAIQNGSSGSNHLLECSALREGRANGEAPAVDLGAADLAHVQQQQQQ
ALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQV
LSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQLLQQQHVGKQPKEQQQVATQQLA
FQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHS
AEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLPHEEHPHSH
PLYGHGVCKWPGCEAVCEDFPSFLKHLNSEHALDDRSTAQCRVQMQVVQQLELQLAKDKE
RLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQG
PSVITTTSMHSVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILE
SPEKQLTLNEIYNWFTRMFAYFRRNAATXXNAVRHNLSLHKCFVRVENVKGAVWTVDEVE
FQKRRPQKISGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLAS
AIREELNGAMEHTNSNESDSSPGRSPLQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPD
FDQDRDYEDEAVHEDME
Download sequence
Identical sequences ENSDORP00000009023 ENSDORP00000009023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]