SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009084 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009084
Domain Number 1 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 38-96
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 346-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 252-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.57e-17
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 193-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000329
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009084   Gene: ENSDORG00000009664   Transcript: ENSDORT00000009665
Sequence length 406
Comment pep:novel scaffold:dipOrd1:scaffold_42290:102:6104:1 gene:ENSDORG00000009664 transcript:ENSDORT00000009665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAAVLLPTCAQPHLYLASLQKEGPGKERLASEVLMGWTRDLVTFKDVAVEFSQEEWALL
DTWQRTLYSEVTLENCRNLVSLGCHVDVPSLAAQLELCPQVGTEESGVVQDTCAELEHAL
QAKWLSPEKHVFRRQQSKHGKTKRSHCGVEPNNNNNKANGFTDSLTQHQRATRESIHHWR
GGGRFYSSTKQPASLTRQDSGHGRANVNECSQCGKAFSSRSYLTIHRRIHNGEKPFACRH
CGKAFSTRRRCRSPTKSHTRTHGGESHHECRQCGKAFSTRSSLTGHRSVHTGEKPFACGL
CGKTFRKSSYLTQHARTHTGEKPYACAHCGKAFSSSFSLTVHKRTHTGEKPYACADCGKA
FNNLSAVKKHVRTHTGEKPYACAHCGKAFTSNSYLSVHQRLHSQWT
Download sequence
Identical sequences ENSDORP00000009084 ENSDORP00000009084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]