SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009095 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009095
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily POZ domain 9.22e-24
Family BTB/POZ domain 0.0018
Further Details:      
 
Domain Number 2 Region: 456-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 498-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000123
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 545-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000394
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 287-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000211
Family Classic zinc finger, C2H2 0.0013
Further Details:      
 
Domain Number 6 Region: 343-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000337
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 7 Region: 384-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000028
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009095   Gene: ENSDORG00000009677   Transcript: ENSDORT00000009678
Sequence length 685
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4503:30785:39056:1 gene:ENSDORG00000009677 transcript:ENSDORT00000009678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSR
GSVVLPAGFSEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCKNFQPQTSM
GQAPSGQSGPGTPVSQDVKGHLKEPSDLEDDEVSKTLGMVPRDQEPMDSHSPQGLSHPAQ
SSPSFLCGKLKQALRSCPSEDKDPGDGKVFTRSFEAEDAPLHRESNEWEVVVQVEDDGDG
DYVSEPETVLSRRKSKVMSKPCAAQPTLGASSLAAEPAESRKGTAVPVECPTCHKKFLSK
YYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRT
ELRTHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHGAPKPHACSTCAKCFLSRTELQ
LHEAFKHRGEKLFVCEECGHRASSRNGLQMHIKAKHRNERPYVCEFCSHAFTQKANLNMH
LRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTGERPFSCEFCEQRFTEKGPLLRHVASR
HQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHMEIHDRV
ENYNPRQRKLRNLVIEDEKVVVVALQPPAELEVGSAEVIVESLAQGGLATQLPGQRLCAE
ESFAGSGVLEPSLIITAAGPEDCDT
Download sequence
Identical sequences A0A1S3GC55
ENSDORP00000009095 ENSDORP00000009095 XP_012886418.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]