SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009119 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009119
Domain Number 1 Region: 824-880
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.84e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.85e-20
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 3 Region: 865-917
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.49e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 622-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000002
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 665-722
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000405
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 412-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000379
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 7 Region: 542-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000703
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 707-762
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000854
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 9 Region: 384-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000108
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009119
Domain Number - Region: 450-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000103
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009119   Gene: ENSDORG00000009702   Transcript: ENSDORT00000009702
Sequence length 973
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1436:33:10047:1 gene:ENSDORG00000009702 transcript:ENSDORT00000009702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRQGWAIRKERSWAERGPRDESNGESKMERRWVRDGDRAETHHRQRQRERERERERLGLE
LRLESGRDMLQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXRKAEEWWEGITVPAATTTEVVTEVELLLYKCSECSQLF
QLPADFLEQQATHFTAPAPETEERALQPETLTPSPAEVPVSQPDALPASDHSYELRNGDT
IGRDRRARKPRRSSSVEPGGTATQELFCSACDQIFLSPHQLQQHLRSHREGVFKCPLCSR
VFPSPSSLDQHLGDHSSESHFLCVDCGLAFGTEALLLAHRRAHTPNPLHSCPCGKTFVNL
TKFLYHRRTHGAGGVPLPTTPVPPEEPVISFPEPAPTETREPEAPEPPVSEESTAEPAAP
STYRCLLCSREFGKALQLTRHQRFVHRLERRHKCSICGKMFKKKSHVRNHLRTHTGERPF
PCPDCAKPFNSPANLARHRLTHTGERPYRCGDCGKAFTQSSTLRQHRLVHAQHFPYRCQE
CGVRFHRPYRLLMHRYHHTGEYPYKCRECPRSFLLRRLLEVHQLVAHAGRQPHRCPSCGA
AFPSSLRLREHRCAAAAAQAPRRYECGTCGKKVGSAARLQAHEAAHAAAGPGEVLAKEPP
APRAPRATRTPVPSPASLGGAASTAPAAPARRRGLECSECKKLFSTETSLQVHRRIHTGE
RPYPCPDCGKAFRQSTHLKDHRRLHTGERPFACEVCGKAFAISMRLAEHRRIHTGERPYS
CPDCGKSYRSFSNLWKHRKTHQQQHQAAVRQQLAEAEAAVGLAVMETAVEALPLVEAIEI
YPLAEAEGVQISG
Download sequence
Identical sequences ENSDORP00000009119 ENSDORP00000009119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]