SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009133 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000009133
Domain Number - Region: 216-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0878
Family Classic zinc finger, C2H2 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009133   Gene: ENSDORG00000009717   Transcript: ENSDORT00000009716
Sequence length 323
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4767:63901:70061:1 gene:ENSDORG00000009717 transcript:ENSDORT00000009716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRRQKRKHLENEESQEDEELGGGISKIQEDGPQPGPTAMATVWSPGVGEVSSASEYFSC
VSPPCKLGHGRCQRVQGSPQIRSPSGQAQEPGETPAPSQQVSSSHSSYQTCVSSLPLNTD
EKGMKIYYMQVQMIKGVAVSWEREETSEILEKQPRMEEAVLLGSVRVGTPPSDVSTRNLL
SDSEPGGEEKEYEEKVESDSTPGSPAVEERPRAKTPDWLVTAENGFRCMACCRVFATMEI
LREHVQYGIREGFSCHVFHLTMAHLIENVESESTQEEEEEEEEEEERPEEENEEQQPTEE
DLGLKRSWSQCPGCVFHSAKDRK
Download sequence
Identical sequences ENSDORP00000009133 ENSDORP00000009133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]