SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009156 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009156
Domain Number 1 Region: 267-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000496
Family HkH motif-containing C2H2 finger 0.067
Further Details:      
 
Domain Number 2 Region: 414-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000923
Family Classic zinc finger, C2H2 0.073
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009156
Domain Number - Region: 200-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000105
Family Classic zinc finger, C2H2 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009156   Gene: ENSDORG00000009741   Transcript: ENSDORT00000009740
Sequence length 853
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1413:6036:29887:-1 gene:ENSDORG00000009741 transcript:ENSDORT00000009740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NQPLGLAQAASWVGPTVRFVSVLTVVEYGGFPHSSQDGYPLTTRTSPQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
TWDSVHTIPVTPKAQPTAAPSNFPCTPSPRPSHRSHEAPMYPSTSSHQSPLARPKTQPPS
PPGPSRRPPPPPARPGSAPWNGPGTNEKPPFPSKGPKASTGPRPAPLHYCEVCKISCGGL
QXXXXXXXGQRHRKKEAAQRAGAQSSGAVQGQLHCDLCSVSCTGADAYAAHIRGAKHKKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCNDEGKLI
RFRCKLCECNFNDLNAKDMHVTGRRHRLQYRRKVDPSLPIASGPNVRLQKALAEQLHRQR
QVTQKKLEDMRQRWRMDLPKRRPESSDDRHVMGKHATIYPTEEELEAIQKTVSHVERALR
MVSDMLAEEEQERAEEEGYEHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXILAEDKYEISSDPEDNVVISSCEEPRIQVTVSITSTLMRED
PSANQGVEDPQDEPDDILSQERCLESLAALRHAKWFQARASGLQPCVIVIRVLRDLCRRL
PTWAALPAWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPGIDPCEKDQTD
ALESMTPQQREDVTASAQHALRMVAFRQIHKVLGMDRLPARSRLGARGRKRPREAVQAPG
VSGERKRGRKGGE
Download sequence
Identical sequences ENSDORP00000009156 ENSDORP00000009156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]