SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009165 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009165
Domain Number 1 Region: 760-814
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 597-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000975
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 861-909
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000116
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 4 Region: 687-737
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000011
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 5 Region: 495-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000876
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009165
Domain Number - Region: 110-225
Classification Level Classification E-value
Superfamily SET domain 0.000278
Family Histone lysine methyltransferases 0.058
Further Details:      
 
Domain Number - Region: 889-943
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000299
Family Classic zinc finger, C2H2 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009165   Gene: ENSDORG00000009748   Transcript: ENSDORT00000009749
Sequence length 1199
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3456:14710:49907:-1 gene:ENSDORG00000009748 transcript:ENSDORT00000009749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAAMAEEGSEEIMFVWCEDCSQYHDSECPELGPVVMVKDSFVLSRARTWPPTGKGTMGGY
AVWGVLGSVSRNQPKPQLLDIHTGGTGQQPLCSPTLGQGGLVAQSRSSLPSNLEIRRLDD
GAEGVFTVTQLVKRTQFGPFESRRVAKWEKESAFPLKVFQKDGHPVCFDTSNEDDCNWMM
LVRPAAEPGHQNLTAYQHGGHVYFTTCRDIPPGTELRVWYAAFYAKKMEKPMLRQACTGV
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQVAETVP
EGLPEEPGSAAPDERIMELVLGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVDGEYQFRCGSCGKAFRMESALEFHNCRTXXXXXXXXXXXXXXXXXXXXXXX
XXXHGDKFACEVCSKMFYRKDVMLDHQRRHLEGVRRVKREDLEASGESLVRYKKEPSGCP
VCGKVFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDEHQREE
FIGKIGISSEENDDNSDGSADSEPHKYSCKRCQLTFGRGKEYLKHIMEVHKEKGHGCSIC
HRRFALKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHA
CEQCGKSFARKDMLKEHMRVHDDIREYLCAECGKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKY
VTEYMLQKHMQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPET
TTIDASSIGIVQPELGLEQEELAEGKHGKTAKRSHKRRRRPGEEAGTPVPEEEAAFGEYT
EKEPQFTGGVGDETNSAVQSIQQVVVTLGDPGVTAPPSSVGLTNITVTPVTTAAGTQFTS
LQPVAVGPLTTPERQLQLDNSILTVTFDTVSGSAMLHNRAHDVQLHPQPEAPSAPSVAHF
INLTTLVNSITPLGSQLGEQHPLTWRAVPPTDAPPRPPAPPQQPAQPQVQPEQPQMFGY
Download sequence
Identical sequences ENSDORP00000009165 ENSDORP00000009165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]