SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009166 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009166
Domain Number 1 Region: 40-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.44e-36
Family SCAN domain 0.00000683
Further Details:      
 
Domain Number 2 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 312-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.05e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009166   Gene: ENSDORG00000009750   Transcript: ENSDORT00000009750
Sequence length 407
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1316:1535:4760:1 gene:ENSDORG00000009750 transcript:ENSDORT00000009750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKMEITLSSNSQASSKQERHIITKLEEKPAPSQQKTCPDPELSRQSFRRLRYQEVAGP
QEALSQLRQLCRQWLQPELNTKEQMLELLVMEQFLIILPPEIQARVRHRCPESSKEIVTL
VEDFNRASKKPKQWVAVCVQGQKMLLERTGAHLGDQELPDFQPQTLTRDLKESFPEDPSQ
EGSHEAPSPHHWEKSPLLQEPAPKLAGTEESGMKSDNKENPRPEGARGTKSGVVPAGRPK
GNALQSPEPRGASLGEAHLSGKQVGPSNAQKPYAPYKRHRRELEYSSPVKSHPLRELKKS
KGGKRTLSSRLQRLAHQPAYTAKKPYKCDDCGKSFTWNSELKRHKRVHTGERPYSCGECG
NCFGRQSTLKLHQRIHTGEKPYQCGQCGKSFRQSSNLHQHHRLHHRD
Download sequence
Identical sequences A0A1S3EQW5
ENSDORP00000009166 XP_012866788.1.60039 ENSDORP00000009166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]