SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009167 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009167
Domain Number 1 Region: 160-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-16
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 2 Region: 206-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000213
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009167
Domain Number - Region: 7-26
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000915
Family KRAB domain (Kruppel-associated box) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009167   Gene: ENSDORG00000009751   Transcript: ENSDORT00000009751
Sequence length 265
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1316:16974:23258:-1 gene:ENSDORG00000009751 transcript:ENSDORT00000009751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTSEAQGPMLFEDLAVHFSQEECVSPHAAPGPRSRKATKECLDNGTRIGVEGKTDINP
QLSLESMEFEEHSQEHSIASPLVDYPESSEDEITLPEWKISSGTSTCKKRFINLLITIDN
HTPLVELSQYLGTRTLSEITEPPGEEPPDNVYQSAERDQTFCDNSYLGLRQKTHSRENQY
TCDDCGKIFNHRANLRTHRRVHTGEKPYKCVKCAARFRQHSHLSRHMKSHTKQKPYPCAI
CGRGFKWLSDLTQHQKSHTAEKTDK
Download sequence
Identical sequences ENSDORP00000009167 ENSDORP00000009167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]