SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009193 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009193
Domain Number 1 Region: 22-196
Classification Level Classification E-value
Superfamily Lysozyme-like 2.02e-22
Family G-type lysozyme 0.00000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009193   Gene: ENSDORG00000009778   Transcript: ENSDORT00000009777
Sequence length 197
Comment pep:novel scaffold:dipOrd1:scaffold_19855:11419:16266:1 gene:ENSDORG00000009778 transcript:ENSDORT00000009777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSRASYSFTHAMNPRLHPRLYHGCYGDIMTMETSGAPCEINNLISCGIRGSEMFAEMDLK
ALKSYQIVIKEVGQRYCIDPAVIAAIISRESHGGTVLQNGWDHRGLKYGLMQLDKQLYHP
VGAWDSKEHLLQGVGILADKIKAIQRKFPTWSVPQHLKGGLSAFKSGIDTIDTPMDIDAD
LVSDIIARAKFFKKHGF
Download sequence
Identical sequences ENSDORP00000009193 ENSDORP00000009193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]