SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009194 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009194
Domain Number 1 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 640-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.39e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 402-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.24e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 682-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 362-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-16
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 8 Region: 724-771
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000147
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 491-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000559
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000229
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009194   Gene: ENSDORG00000009776   Transcript: ENSDORT00000009778
Sequence length 773
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5642:11964:28014:-1 gene:ENSDORG00000009776 transcript:ENSDORT00000009778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLLDQSWGMAAADRWASWAVCPQDPSWHAEEIPEDRKRAAGLPAAQVQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQIKPEVISLEQGGEPWLVEQACSQSTHQ
ELMRSLESKSLIPTQSVFEEQPCGMKLERYIWDEPWFSRLGVWGCKDQLEMNQSTAMRQM
VFMQKQVLSQRGSEFCGFGTEYSQSLTFVPSQRVSQLEHFYKPETHAESWKYNSAIMCAD
KVSCENTDHDKALYQSILPIHSARMQTGDNLLKCADAVKSFNHIIHFGDGKGMHTGEKLY
EYKECHQVFNRSPSFNEHPTLHSRENQCDYKEYENIFYFSSFMEHQKIGPTEKYKYEWEK
VFGYDSFLTQHTSAYTAEKPYEYNECGTSFIWSSYLIQHKAHTGEKPYECDKCGKAFRNR
SALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTGEKPYVCNECGKSFNWNSHLI
GHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPFKCDECEKAFRDYSALSKHER
THSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQECGKAFRERSALTKHEIIHSG
IKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKSFSQSCHLVAHRRIHTGEKPY
KCNQCDRSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNESSSLIVHLRNHTGEKPYKCSH
CEKAFCKNSSLIIHQRMHNGEKRFICNDCGRAFSGHSALLQHQRNHSEEKLNR
Download sequence
Identical sequences ENSDORP00000009194 ENSDORP00000009194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]