SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009233 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009233
Domain Number 1 Region: 335-437
Classification Level Classification E-value
Superfamily BRCT domain 5.1e-26
Family DNA topoisomerase II binding protein 1, TopBP1 0.00000482
Further Details:      
 
Domain Number 2 Region: 189-277
Classification Level Classification E-value
Superfamily BRCT domain 6.8e-24
Family DNA topoisomerase II binding protein 1, TopBP1 0.023
Further Details:      
 
Domain Number 3 Region: 52-171
Classification Level Classification E-value
Superfamily BRCT domain 3.27e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.064
Further Details:      
 
Domain Number 4 Region: 923-989
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000196
Family DNA topoisomerase II binding protein 1, TopBP1 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009233   Gene: ENSDORG00000009820   Transcript: ENSDORT00000009822
Sequence length 1232
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4681:227:31446:-1 gene:ENSDORG00000009820 transcript:ENSDORT00000009822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFVKFLKSPANSECFFKALESIKEFHSEEYLQMITEEEAIQMKKNDRSLYICDPFSGPVF
EHLKKLGCRIVGPQVVLFCMRHQQCVPRAEHPVYNMVLSDVTVSCTSLEKDKREEVHKYV
QMMGGQVYRDLNISVTHLIAGEVGSKKYLVAANLKKPIMLSSWIRTLWEKSQENKIARHT
EVNMEDFRCPVFLGCVICVTGLGGADRKEVQQLTVQHGGQYMGQLKMNECTHLIVREPKG
QKYECARKWNVHCVSTRWFFDSVEKGFCQDESMYKVEPAPAARSGPNTSTPTGPGSTSEI
QALSNVSRISSVSGSYINESVCSSALSSKLDSTAENLDTLDISAFQAPEDLLDGCRIYVC
GFSGRKLDKLRRLVNSGGGIRFNQLSEDVTHVILGDYDDELKQFWSRSAHRPHVVGARWL
LECFSKGYLLPEEPYLHTRYQPAEIAAADQPESKAAPSNKSNGGFCAPHVTPREAPEPAD
EELLSQYASNDSTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXHSLANGLANGVPCAAQPGQQPRGKPAVSPLDMNRFQSKAFQA
VMLQHAGPAAASPPGAQRLQKEPSLHLDTPSKFLSKDKLFKPAFDVKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXWSFDETVTHFIYQGRANDTNREFKSARERGVHVISEHW
LLECDQAYKHLPKCLYPCIYNPKMKMHARHKGQICSSQVVSADDGPDHLLVEENARHTMT
TSNNSNRIGRNDAKVALTQTLEMRETFQRQLQEIMSATSLVKPPAPRPALAPSGCPSTAS
TPDNLRAVRSSRSRVLEALRQSRQSEPDVNTEPSQSEQIIWDDPTAREERARLASSRQWP
GCPTPRPEPRVDLNGLADPAVWEPVRDADGTEQAVCDPRYTSVIEAPGPVISDEVEFPTK
AKREDHLIPTPQAPSIAFPLAHPPVAPRPKEQ
Download sequence
Identical sequences ENSDORP00000009233 ENSDORP00000009233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]