SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009242 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009242
Domain Number 1 Region: 38-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.71e-39
Family SCAN domain 0.0000465
Further Details:      
 
Domain Number 2 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 304-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 405-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-18
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009242   Gene: ENSDORG00000009833   Transcript: ENSDORT00000009831
Sequence length 464
Comment pep:novel scaffold:dipOrd1:scaffold_32666:6868:11252:-1 gene:ENSDORG00000009833 transcript:ENSDORT00000009831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKVVGMATVLGPRLAQEHAGPIAVKVEEEEDKRKCRPGLEMFRQRFRQFGYHDTPGPRE
ALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPRELRAWVQEHCPESAEEAVTLLE
DLERELDEPGLQISTPPSEQKQMSPSGTAEESPSREQVTSPKYDSWGPLYIQETGEEQVF
TQDLRKIQGCKSNPQNEESADEQKSSEEDGLMRDFIPVIIANKCEVRAERQWVNPERGRG
AKAPPHHAGSKKGTESVSPKSAPGARRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTK
CGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAF
SGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKECGKAFNHSS
NFNKHHRIHTGEKPYWCSHCGKSFCSKSNLSKHQKVHSGEGQGL
Download sequence
Identical sequences ENSDORP00000009242 ENSDORP00000009242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]