SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009249 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009249
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Lysozyme-like 1.44e-35
Family C-type lysozyme 0.00000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009249   Gene: ENSDORG00000009838   Transcript: ENSDORT00000009838
Sequence length 97
Comment pep:novel scaffold:dipOrd1:scaffold_34623:5904:7444:1 gene:ENSDORG00000009838 transcript:ENSDORT00000009838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACIIFHTSGFDTQTIIKNNGSTEYGLFQISNNFWCKSHQIPQSRNICNITCESLLDDNLT
DDVKCVQKILDIKGIDYWLAHKALCSEKLEQWRCETL
Download sequence
Identical sequences ENSDORP00000009249 ENSDORP00000009249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]