SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009257 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009257
Domain Number 1 Region: 358-483,545-576,610-643
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.52e-35
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily RING/U-box 2.52e-19
Family ZZ domain 0.0053
Further Details:      
 
Domain Number 3 Region: 68-101
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 0.00000000262
Family Mib/herc2 domain 0.0027
Further Details:      
 
Domain Number 4 Region: 867-927
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000501
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009257
Domain Number - Region: 738-782
Classification Level Classification E-value
Superfamily RING/U-box 0.00202
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number - Region: 785-830
Classification Level Classification E-value
Superfamily RING/U-box 0.00812
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009257   Gene: ENSDORG00000009847   Transcript: ENSDORT00000009847
Sequence length 928
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1213:9007:61094:1 gene:ENSDORG00000009847 transcript:ENSDORT00000009847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLRHRFYRITTPGSERVLL
ESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLD
LEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIV
RSGDAVQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYS
DSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLKKLFETQESGDLNEELVK
AAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLXXXXXXXXXXDKDG
DRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPS
LQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMRVLLS
KLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNT
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQV
QSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRVPFIMCCGGK
SSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLC
GHGTCQLCGDRMSECPICRKAIERRILL
Download sequence
Identical sequences ENSDORP00000009257 ENSDORP00000009257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]