SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009277 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009277
Domain Number 1 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 382-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 438-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.29e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 344-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000669
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009277   Gene: ENSDORG00000009870   Transcript: ENSDORT00000009870
Sequence length 540
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6386:60342:62317:-1 gene:ENSDORG00000009870 transcript:ENSDORT00000009870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREESPWGLEPRDVQSPDEMGSPEGSLKGNTSENEEEEISQQEGNGDYEVEEIPFGLEP
QSPGFEPPSPEIESQSPRFEPESPGFESRSPGFVPPSPEFAPRSPESDPQSPEFESQSPR
YEPQSPGYDPKSPGYEPRSPGYESQSPGHESQNPELKIQNPELEAQSSKFQEGTEILLNP
EEKNPLSIPLGVHPLDSFTQEFGEQPTGALSLGPPFEMPTGALLSTPQFEMLQNPLGLTG
TLRGPGRRGGRSRGGQGPRPNICGICGKSFGRGSTLIQHQRIHTGEKPYKCEVCSKAFSQ
SSDLIKHQRTHTGERPYKCPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYL
LRHQRTHSHERPYSCPECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHA
RSHAREKPFKCPECGKRFGQSSVLAIHARTHLPGRTYSCPDCGKTFNRSSTLIQHQRSHT
GERPYRCAVCGKGFCRSSTLLQHHRVHSGERPYKCDDCGKAFSQSSDLIRHQRTHAAGRR
Download sequence
Identical sequences ENSDORP00000009277 ENSDORP00000009277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]