SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009278 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009278
Domain Number 1 Region: 267-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 2 Region: 211-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-19
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 24-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-17
Family KRAB domain (Kruppel-associated box) 0.0029
Further Details:      
 
Domain Number 4 Region: 312-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 174-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000242
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009278   Gene: ENSDORG00000009872   Transcript: ENSDORT00000009871
Sequence length 408
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6386:69187:72939:-1 gene:ENSDORG00000009872 transcript:ENSDORT00000009871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLAPIPTREPSGAAPACRKPGAVSFADVAVYFSPEEWGCLRPAQRALYRDVMRETYG
LLGALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSRNKEEKRGREPVEA
LQETLSPDPGPPGMQGLGLPSAGLPQGWRQQKAPHRGRPPLRAHPSVPRADQRHGCYVCG
KSFAWRSTLVEHLYTHTGEKPFHCPDCNKGFGRASSLSKHRAIHRGDRPHRCPDCGRAFT
QRSALNTHLRVHTGEKPYCCADCGRCFSQSSALHQHQRVHSGLTPFPCADCGRAFAHASD
LRRHMRTHTGEKPYPCPDCGRCFRQSSEMAAHRRTHSGERPYPCPQCGRCFGQKSAMAKH
QWVHRPGAGTRGSRGASGFPGSLAPDPGDLDPPVGFQHYPEIFQECRA
Download sequence
Identical sequences ENSDORP00000009278 ENSDORP00000009278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]