SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009281 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009281
Domain Number 1 Region: 391-447
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-20
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 2 Region: 543-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000896
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 3 Region: 118-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000717
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009281
Domain Number - Region: 161-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000426
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009281   Gene: ENSDORG00000009873   Transcript: ENSDORT00000009874
Sequence length 638
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6386:80268:87826:-1 gene:ENSDORG00000009873 transcript:ENSDORT00000009874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEAGPQRLPYQDKILSAEGILQFSGLKPAFISQMEDEVEIWISETDPEGESPLAVNWQGK
VTGSNKNEKEGLKKNSKQKEIGDEIPLQERLSWHATWFFCTPWSPIKPWLRDIPGARAPY
SYSNCGPSFSYPSLLVSYLRVYTRERPFSCDAHFSPHNLLLWFTHSGKKPYPCSEGGCHF
AFLAIHWAHTRENPYPFPNCKSHFTPYLLASHRHDHGEKTYPCLDGLHFTYSPLLLSVWP
ISCSQCGTSCKRRLKAYWVPCSGEERLRWPQAAFSEHVLGDQDPLVYFWDIFQESPLRPG
QSAHSVVRSSSQSSAGIHRQAGRRREAAGTSIFLEGKKFLDFPIPQEEKSPVAAIEFKGR
REAETKEMAPPPAPLLALGPGELPPACRKPGAVSFADVAVYFSPEEWGCLRPAQRALYRD
VMRETYGHLGALGLPGPKPALISWMEGESEAWNPAAQDPEEGENLGGALRGDAPNQKEGE
PKGRPEAVGPGKEKPKPLVKHKRDSAVSKTSARAQRRKEVRDQVSTAQPPVAVPGVDAQA
CQRRHVCTDCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIHRSCSG
GRRGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECS
Download sequence
Identical sequences ENSDORP00000009281 ENSDORP00000009281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]