SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009283 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009283
Domain Number 1 Region: 268-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.02e-23
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 2 Region: 324-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 184-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 28-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-20
Family KRAB domain (Kruppel-associated box) 0.003
Further Details:      
 
Domain Number 5 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 421-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 148-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000185
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 230-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000039
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009283   Gene: ENSDORG00000009876   Transcript: ENSDORT00000009876
Sequence length 498
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6386:91674:95977:-1 gene:ENSDORG00000009876 transcript:ENSDORT00000009876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSAPLPAPGPGEARPSRRRGRRPRALKFADVAVYFSPEEWGCLRPTQRALYRDVMRE
TYGLLGALGCAGPKPSLISWLERNTENWEPAALDPQEYRKGVTVQRKTRRKNGEKDVLPP
KEAPRKGKRGRRPSKPRLVPRQTSGGPICPDCGCTFPDSHALESHKCAQNLKKPYPCPDC
GRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGRCF
RRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCPECSRRFRQRT
ALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHCQARFSQRSTLLQ
HQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACEDCGRRFAYPSLLASHRRV
HSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCSPKVP
NRSPRSAVGGPSQKGGAL
Download sequence
Identical sequences A0A1S3ESF2
ENSDORP00000009283 XP_012866854.1.60039 ENSDORP00000009283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]