SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009366 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009366
Domain Number 1 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-19
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 48-180
Classification Level Classification E-value
Superfamily SET domain 0.0000000000343
Family Histone lysine methyltransferases 0.064
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009366
Domain Number - Region: 275-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000158
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009366   Gene: ENSDORG00000009966   Transcript: ENSDORT00000009965
Sequence length 397
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_388:17670:110013:1 gene:ENSDORG00000009966 transcript:ENSDORT00000009965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDMCADNRHGECPMHGPLHSLRRLVGTSSAAAAAPPPELPEWLRDLPREVCLCTSTVPGL
AYGICAAQRIQQGTWIGPFQGVLLPPDKVQAGAVRNTQHLWEIYDQDGTLQHFIDGGEPS
KSSWMRYIRCARHCGEQNLTVVQYRSNILYRACIDIPRGTELLVWYNDSYTSFFGIPLHC
IAQDENLNVPSPVMEAMCRQDALQPFGKSSKLPPAAQQRSVVFPQAPCSRSFSLLDKAGP
IEPGFNQINVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFKTFTQRILLQMHVCTQNPD
XXXXXXXXXQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAGATTLNNHIRTHTGEKPFK
CERCERSFTQATQLSRHQRMPNECKPITESPESIEVD
Download sequence
Identical sequences ENSDORP00000009366 ENSDORP00000009366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]