SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009398 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009398
Domain Number 1 Region: 143-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000115
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 1104-1153
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000029
Family Myb/SANT domain 0.0039
Further Details:      
 
Domain Number 3 Region: 177-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000994
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009398
Domain Number - Region: 778-807
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00134
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009398   Gene: ENSDORG00000009996   Transcript: ENSDORT00000009997
Sequence length 1239
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2118:67995:83073:-1 gene:ENSDORG00000009996 transcript:ENSDORT00000009997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPYSPEDEGALPSEMHLPSFSDSQGLNCNDTVSRDLGPSTRDLLYAGLSGLDLDPSLPA
SDMPSEVLEDNLDTLSLYSGKDGDSVKLLEEYADSESQTSLQDLGLGALKVPKEADEGGR
ATSGSARKGKRQHSSPQNPLLDCSLCGKVFSSASSLSKHYLTHSQERKHVCKVCSKAFKR
QDHLTGHMLTHQKTKPFVCIEQGCSKSYCDYRSLRRHYEVQHGLCILREAPPEEEAFGDP
RIDLPPPSALRPPGPPEARSPSSVLPNRDLLRCIVSSIVHQKIPSPGPALAGPSEGDGRG
AGSSSCTPAAAPGAPGGAEGPEDPQPPRTEAAAEDARAAAPSRAAENGALDAPELEPAQP
PARESWAEGGALPARLPLFRGAAAGAPTPGHSFPWLRSLPGCPKGKGGGVLVLHKAPSPA
PSPPAEPAPGGAAEPAPPRRPARCAADEDNNGWPSRRSKPEDGEPLSWPSPGEPDARAAE
AAPLFRQLLLKSQEALAGHEQVQMLQVLSASQRLFPRAPPTPQAALKSLQGAWPQQPPPP
APAAADALQGGPGHPEPEGSPARRRKTAPAAPRETSPSGGGTRRDAKGGLKVASAPPSLP
APLEASRNPDISSLAKHLRSSKGTLDLGDIFPAAGARQPQHGAEEPPGAPLPGKQAQADG
CAVAGATRPDKGPACPRGASYRLFSGNPRAQRFSGFRKDKVKMDVCCAASPSQVAMASFS
SSGPPADPGRDVKSKLTIFNRIQGGNIYRLPHPMKEENVAGGCHQPNGGPTDWTEPRSTF
VCKNCSQMFYTEKGLSSHMCFHSDQWPSPRGKQEQQGFGTEFCKPSRQVLRPDGDGQSPP
GGRKSLDSMATAPLVIPLSVPVTPAPRRLGGAAKGQEKDGEERDSKDSRQQRKRKKRPPP
SALGEPAPGGGCHQSCLPSPVLLVDHLLKGLFQCSPYTPPPMLSPIREGSGLYFNTLCPV
PQAGPYQLFSSVLDQVDGSFGICVVKDDTKISIEPHINIGSRFQAEIPELQERSLAGVDK
HVAALVWKPWGDVMTNPETQDRVTELCNVACSSVMPGGGTNLELALHCLHEAQGSIEVAL
ETLLLRGPQKSRAHPLADYRYTGSDIWTPMEKRLFKKAFCAHKKDFHLIHKTIQTKTVAQ
CVEYYYIWKKVIKFDCGRAPGLEKRVRRELDEVERTEEKVTCSPRERSSHRPTPELKIKT
KTYRRESILSPSPSTGPKRTPEPPGSVEGQDVFPCRECE
Download sequence
Identical sequences ENSDORP00000009398 ENSDORP00000009398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]