SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009413 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009413
Domain Number 1 Region: 809-986
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 378-495
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.32e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.00094
Further Details:      
 
Domain Number 3 Region: 520-691
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-26
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 
Domain Number 4 Region: 249-372
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000148
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 5 Region: 705-834
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000588
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009413
Domain Number - Region: 1120-1190
Classification Level Classification E-value
Superfamily PH domain-like 0.000438
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number - Region: 1021-1103
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000486
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009413   Gene: ENSDORG00000010012   Transcript: ENSDORT00000010014
Sequence length 1293
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6143:105426:143817:-1 gene:ENSDORG00000010012 transcript:ENSDORT00000010014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPRTAPSHLLVSLPSKEEELLLSSLSAGPQPEPVELPSALPSTLFQAPPQPPSPPLCPPE
IPPKPLRLPPEFDDSDYDEAPEEGPGAPASVMTKKEEPPPIRVPRAVRVASLLSEGEELS
GDDEDEDDHAYEGISNSGWPTSSLSPTLPSLIAPPYPMDELPGGSTPTTSVIKAGWLDKN
PPQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXERKEWMQALQQAVAEQHARARLSSAYPLGVQGSDQPDRAGSLELRGFKNKLY
VAVVGDKVQLYKNLEEYHLGIGITFIDMSVGNVKEVDRRSFDLTTPYRIFSFSADSELEK
EQWLEAMQGAIAEALSTSEVAERIWTAAPNRFCADCGAAQPDWASINLCVVICKRCAGEH
RGLGAGVSKVRSLKMDRKVWTETLIELFLQLGNGAGNHFWAANVPPSEALQPSSSPSARR
HHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGVSCFSGDPEA
PTPLALAEQAGQTLQMEFLRNNQTMEVPRLDSLKPLEKHYSVVLPTVSHSGFLYKTASAI
KLLHDRRAREEFSRRWCVLSDGVLSYYEHERAVTPNGEIRASEIVCLAVPPPDSHGFEHT
FEVYTEGERLYLFGLESAELAHEWVKCIAKAFVPPLAEDLLAQDFERLGRLPYKAGLSLQ
RTQEGWFALTGSELHAVFPEGPCEEPLQLRRLQELSVQGDNENQVLVLVERRRTLYIQGE
RRLDFMGWLGAIQKAAASLGDTLSEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQ
TSKTQRLLESLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLAWLEASEI
EDEEEKVSRYQELLVHLPPVNRATVKALISHLYCVQCFSDTNQMTTHNLAIVFGPTLFQT
DGQDYKAGRVVEDLISHYVVVFSVDEEELRKQREEVTAIVKMRVAGTASGTQHAGDFICT
VYLEEKKAETEQHVKIPASMTAEELTLEILDRRNVGIKEKDYWTCFEVNEKEEAERPLHF
SEKVLPILHGLGTDSHLVVKKHQSMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSG
GFHDRYFILNSSCLRLYKEVRSQRPWSGAPETSHRPEKEWPVKSLKVYLGVKKKLRPPTX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDGLVWPSEPSRVSRAVPEVRL
GSVSLIPLRGSENEMRRSVAAFTSDPLSLFRHV
Download sequence
Identical sequences ENSDORP00000009413 ENSDORP00000009413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]