SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009438 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009438
Domain Number 1 Region: 61-294
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.88e-49
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 360-446
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000118
Family Ankyrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009438   Gene: ENSDORG00000010041   Transcript: ENSDORT00000010040
Sequence length 527
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5103:625:12505:-1 gene:ENSDORG00000010041 transcript:ENSDORT00000010040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNYDSDEDTDTDFDTQLVIHQSLLRDIYKLGATEHAPDDNSFHSFLSADYKKILKAIEA
VGEEEALSHLTTCHSAFDEADGIGWIPLHKAAVQLNKNILEMTLRASKPSMWEQTTHNGE
TPLFLAVSNCLLENASFLLLNGCNPNAKNVEGNSPLLTAVLRDSYDMAALLISRGADVNL
RCANERTALHEAAKLGRQDMVKLMLLSGAQPDPQSSYGFTPLALAAQGGHTEIMELLLQK
GKIFASDASSILLEAARGGNPDSVTLLLEYGADANIPKNSGHLPIHVAADRGHLXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY
FAVSNGDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELINLLLRHGANVNYFCRVNPL
HFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHRSHTFEGWTPTVIKDTMFCEV
ITLSWLQHLSGKVVRVMLDYVDQVQICSKLKDVLQKQRLWSEIHFIM
Download sequence
Identical sequences ENSDORP00000009438 ENSDORP00000009438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]