SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009461 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009461
Domain Number 1 Region: 377-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000122
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 743-792
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000015
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 781-825
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000837
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009461
Domain Number - Region: 168-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00947
Family Plant C2H2 finger (QALGGH zinc finger) 0.063
Further Details:      
 
Domain Number - Region: 478-508
Classification Level Classification E-value
Superfamily ARM repeat 0.0489
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009461   Gene: ENSDORG00000010064   Transcript: ENSDORT00000010064
Sequence length 835
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2198:99602:187268:-1 gene:ENSDORG00000010064 transcript:ENSDORT00000010064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDI
LIFIEHKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGI
CPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFT
SAWFLLQHAQNTHGLRIYLESEHGSPLTPRVGIPSGLGAECPSQPPLHGIHIADNNPFNL
LRIPGSVSREASGLAGRFPPTPPLFSPPPRHHLDPHRIERLGAEEMALATHHPSAFDRVL
RLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGSKPPFLATPPLP
PLQSAPPPSQPPVKSKSCEFCGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKLK
RHMKTHMHKSSPMTVKSDDGLSTASSPEPGTSDLVGSASSALKSVVAKFKSENDPNLIPE
NGDEEEEEDDEEEEEEEEEEEEELTESERVDYGFGLSLEAARHHENSSRGAVVGVVGDEG
RALPDVMQGMVLSSMQHFSEAFHQVLGEKHKRGHLAEAESHRDTCDEDSVAGESDRIDDG
TVNGRGCSPGESASGGLSKKLLLGSPSSLSPFSKRIKLEKEFDLPPAAMPNTENVYSQWL
AGYAASRQLKDPFLSFGDSRQSPFASSSEHSSENGSLRFSTPPGELDGGISGRSGTGSGG
STPHISGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACA
QSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE
Download sequence
Identical sequences ENSDORP00000009461 ENSDORP00000009461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]