SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009646 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009646
Domain Number 1 Region: 2096-2122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000987
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009646
Domain Number - Region: 397-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000426
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 1785-1811
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000645
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number - Region: 2010-2039
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00417
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 1953-1981
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0043
Family Classic zinc finger, C2H2 0.0011
Further Details:      
 
Domain Number - Region: 948-973
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00737
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number - Region: 1742-1770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00781
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009646   Gene: ENSDORG00000010262   Transcript: ENSDORT00000010262
Sequence length 2561
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6260:19027:50431:1 gene:ENSDORG00000010262 transcript:ENSDORT00000010262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENGSCELQFLATLAQETGVWKNPVLRTILSQDPLDKDKAFEGPILLDMRIKHLIKTNQL
SQATALAKLCSDHPEIGTKGSFKQTYLVCLCTSSPNEKLIEEISEVDCKDALEMICNLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXELTLFWSKLQQRVEPSIQVYLERCRQLSLLTK
TVYHIFFLIKVINSETEGAGLATCIELCVKALRLESTENTEVKISICKTISCLLPDDLEV
KRACQLSEFLIEPTVDAYYAVEMLYNQPDQKYDEENLPIPNSLRCELLLVLKTQWPFDPE
FWDWKTLKRQCLALMGEEASIVSSIDELNDSEVYEKVVDYQEESKGTSVNGLSGGVGANS
GLLKDIGEDKQKKKEIKQLRERGFISARFRNWQAYMQYCVLCDKEFLGHRIVRHAQKHYK
DGIYSCPICAKNFNSKETFVPHVTLHVKQSSKERLAAMKPLRRLGRPPKITTTHENQKTN
TVAKQEQRPIKKNSLYSTDFIVFNDNDGSDDENDDKDKSYEPEVIPVQKPVPVNEFNCPV
TFCKGFKYFKNLIAHVKGHKDNDDAKRFLEMQSKVICQYCRRHFVSVTHLNDHLQXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXDHNTPPEKVLPPEDQLSSSGESIQLSRVNQSTEDNSEK
EKSMLPSENNIENSLPIDTSNVWDKSKAESAVKKDHISASELRQANGQLSNNLENPTATP
LLQASEVAVSIKVSLNQGIEDNFGKQENSTVEGNGELLVTNLCTPAKDTCNDLCHPGFQE
RKEQNCFNETQIAQNSLINSETLKIGDLNPENLERQVNSLMTFSVQNQAGFQNNLPPSKF
ECGDNVKTSSSLYNLPLKTLESITFVPSQSNLNPIGTPSVPPKAPVQKFSCQVEGCTRTY
NSSQSIGKHMKTAHPDQYAAFKMQRKSKKGQKSNNLNTPNNGKFVYFLPSQVSSSNNAFF
TSQTKVNGNPTCSTQHVSPSIFPAHLANVSTPLLPSVESVMNPNISSQDKNEQGSVLCSQ
MENLSNTTLPAQMEDLTKTVLPLNIDSGSDPFLPLPAESSSISLFSSPADSGTNSVFSQV
ENNTNHYSSQIEGNTNSSFLKGSSGENAVFPVTSDFSNTSAQQSAPEKVKQDRGRGPNGK
ERKPKHNKRAKWPAIIRDGFICSCYRAFTNPSLGGHLSKRSYCKPLDGAEIAQELLQNNG
QPSLLASMILSTNAVNLQQPQQSTFSPEACFKDPSFLQLLAAESRSSTFLPNTFPRSGVS
NFNTNVSQEGSEIIKQALETAGIPSTFESAEMLSQVVGTSCVSDAAQVNATVMPNPAGPT
LLPTVCHPNTLLTNQNRTPNSKAPTIEEGSSLPVFPTNDLLLKTAENGLCSSSFTNSTVP
SQNFNSNSSRVSVISGPQNARCSHLNKKGNSASKRRKKATPPLIAPNASQSLVPSELATM
GLIAKSTEIPTTNLHSNVISNCEPQGLVENITHKLNNVDNQFVTDVKENFKTNLEAHTAL
APLTLKTENGDSQMMALNSCTAVNSDLQISEDNVIQNFEKTLEIIKTAMNSQILEVKNGS
QGAGEPTQNAQVNYSIQLPSVNPVQNNKLPESSQFSSFISIMPTKSNIPQSEVLHKEDQI
QEILEGLQKLKLENDLSTPTTQCILVNTSVTLTPPTKPIPNVAVVQPVSEMIHIQFSDRV
NKPFVCQNQGCNYSAMTKDALFKHYGKIHQYTPEMILEIKKNQLKFAPFKCVVPTCTKTF
TRNSNLRAHCQLVHHFTTEEMVKLKIKRPYGRKSQNENLSASRITQVNKQPTITEDTKKE
FQPALELGSETENALNVALVPDKQLTEKKSPDKTEVSSQLITVMSEPFNPNSLTNIQTKI
RKIRRHRKEREEKKRKKPTSQSLELPTRYSPYRPYRCVHQGCFAAFTIQQNLILHYQAVH
KSDLPAFSAEVEEESEACKESEETETKIMKEFRCQVSDCSRIFQAITGLIQHYMKLHEMT
PEEIESMTASVDVGKFPCDQLECKSSFTTYLNYVIHLEADHGIGSRTSKTEDDGIYKCDC
EGCDRIYATRSNLLRHIFNKHNDKHKAHLIRPRKLTTGQENMSSKANQEKSKSKYRGTKH
NRSGKEGIKMPKTKRKKKINLENKNAKIVQIEENKPYSLKRGKHVYSIKARNDALSECTS
RFVTQYPCMIKGCTSVVTSESNIIRHYKCHKLSKAFTSQHRNLLIVFKKCDNSQVKETSE
QEGNKNDVKESDTCVSETSDSSKTTVPQKEFEKNEKDEMDELTELFITKLINEDSTSVET
QANTSSSVNHDFQENNPCQSERQKAGNLKRVNKEKNVPQNKKRKIEKTEPELAVELGSTH
KEEETAVGIQTTEEHPASFDWSSFKPMGFEVSFLKFLEESAVKQKKNADKDHPNSGNKRT
SHSNSRKNTDKTAVTSGNHVCSCKESEIFVQFANPSQLQCSDNVKIVLDKTLKDYTELVL
KQLQEMKPTVSLQKLEVHSNDLDISVMKEICVGKATGRGQY
Download sequence
Identical sequences ENSDORP00000009646 ENSDORP00000009646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]