SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009656 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009656
Domain Number 1 Region: 13-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000096
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 152-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000426
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 60-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000848
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009656
Domain Number - Region: 118-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00946
Family Classic zinc finger, C2H2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009656   Gene: ENSDORG00000010272   Transcript: ENSDORT00000010272
Sequence length 465
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1815:280196:284638:-1 gene:ENSDORG00000010272 transcript:ENSDORT00000010272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFHCQICGKNFLTLEKFTIHNYSHSRERPFKCAQDECGKAFVSKYKLMRHMATHSPQK
SHRCAHCEKTFNRKDHLKNHLQTHDPNKMSYGCEECGKKYTTVLGYKRHVALHAAHNGDL
TCGVCALELGSTEVLMSHLKTHSEEKPPSAAREKKHRCDHCARSFYTRKDVRRHLVVHTG
CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMRESLQAGELLNPFPAAPPPFQFKAAAPP
PFAVGPTPHGGLLGSLPADLQGLTLGPPEPILQPMPPMPEPLAPMHPMVAPGSPALTLQG
PKYELGATCYPAPPLAGLPLKADPKGFCNMGVYDELPLQEPLSPHKLNQGFELVKIEPGM
LSLPKELQVDALSMAIPASLEISPLLGFWQVPSPPSPTGFGNNFVPMGPGEPLPRRPSCP
QQQQQLLPPPIGTVSLSQLPLPPMPYVFTTGPSTAILPHFHHAFR
Download sequence
Identical sequences ENSDORP00000009656 ENSDORP00000009656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]