SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009659 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009659
Domain Number 1 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.53e-18
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 958-1014
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.72e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 1698-1756
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 649-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 463-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000244
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 6 Region: 1203-1255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000302
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 694-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000985
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 1003-1055
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000337
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 9 Region: 501-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000359
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 10 Region: 179-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000155
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 11 Region: 45-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000173
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 12 Region: 1635-1686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000149
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 13 Region: 1747-1779
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000416
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 14 Region: 19-58
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000266
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009659
Domain Number - Region: 264-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00183
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009659   Gene: ENSDORG00000010273   Transcript: ENSDORT00000010276
Sequence length 1822
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2677:3176:70123:1 gene:ENSDORG00000010273 transcript:ENSDORT00000010276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVLPLDADNIDDDCPIPNFHKCEICLLSFPKESQFQRHMRDHELNDKPHRCDQCPQTFNV
EFNLALHKCTHNGEDPACPVCHKKFSRVASLKAHIMLHEKEEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSGTRSYNRNIDRSGFTY
SCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMVKHTGEKPHACAF
CPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMHMGGASNSTG
STETAHVITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSIREENGVRWHVCPYCTKEFRKPSDL
VRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQHCMKSFSTSGSLKVHI
RLHTXXXXXXXXXXXXXXXXXXXXXXXXXXXXKHTELRKMRHQRKPTKVRIGKTNVPVPD
IPLQEPILITDLGLIQPIPRSQFFQSYFNNNFVNEADRPYKCFYCHRAYKKSCHLKQHIR
SHTGEKPFKCAQCGRGFVSAGVLKAHVRTHTGLKSFKCLICNGAFTTGGSLRRHMGIHND
LRPYMCPYCQKTFKTSLNCKKHMKTHRYELAQQLQQQQQAASGDDSTVDHQGLQVSAPMP
VEMESTELQPAAEPVTADPEMLDLGPQHVVGTKNGGSPHPLADQPLEAEEDGFAAPQDPL
PGHMDQFEEQTPPQQPFESAGLPQGFPVTDTYNQQTPFPPVQQLQDSSTLESQALSTTFH
QQNLLQVSSSDTINVTTPLLPESSQEELDLQPQRPQFLEDSEDQSRRTYRCDYCNKGFKK
SSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSICSASFTTNGSL
TRHMATHMSMKPYKCPFCEEGFRTAVHCKKHMKRHQTVPSAAATTTETEAGDTCLEDEEE
NSDRSASRKPRPEVITFTEEETAQLAKIRPQESATVSEKVLVQSAAEKDRISEMKDKQAE
LEAEPKHANCCTYCPKSFKKPSDLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFRTSGRRKTHMQFHYKPDT
KKARTSVAQSPSEGLRPVNLLSSSSPDPSVFIMNNSVLTGQFDQNLLQQGLVGQAILPAS
VSXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGPNQISGIDASSNNITLQIDSLLQQTLQQ
SSLLTQPLSGESGMASQSSSVPTTPDSTVPTSVVIQPIPGLSLQPTVTSANLTIGPLSEQ
DSVLTTSSSGTQDLTQVVASQGIVSTSTGPHEITLTINNSSLSQVLAQAAGPTATSSAGS
PQEITLTISELNPASGTIPSSTPMSPSAISSQNLVMSSSGMGGDASVTLTLADTQGVLSG
GLDTVTLNITSQGQQFPTLLTDPSGQGGAGSPQVILVSHTPQSSSAACEEIAYQVTDVST
HLAASSQPEKEGPAHQCLDCERSFSSAAVLMHHSKEVHGKERIHGCRICRKAFKRATHLK
EHMLTHQAGPSLSSQKPRVFKCDTCEKAFAKPSQLERHSRIHTGERPFHCTLCEKAFNQK
SALQVHMKKHTGERPYRCAYCVMGFTQKSNMKLHMKRAHSFVGTLQATAVVQEQDGEELR
ALRLEEAVQEAAGEWQTLTNVF
Download sequence
Identical sequences ENSDORP00000009659 ENSDORP00000009659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]