SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009673 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009673
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-27
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.81e-24
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 572-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 363-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 488-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 436-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000738
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 204-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000056
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009673   Gene: ENSDORG00000010290   Transcript: ENSDORT00000010290
Sequence length 633
Comment pep:novel scaffold:dipOrd1:scaffold_31069:6859:17466:-1 gene:ENSDORG00000010290 transcript:ENSDORT00000010290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRPPTAASKESVTFKDVAVDFTQEEWYHVDPAQRSLYRDVMLENYSHLVSLGYQVSKP
EVIFKLEQGEEPWISEREIQRPFCPDQKTRREAISSNLLQSTSEVSRHQDERSHAALQDG
WDVSSQLERHQENWKGHLGSKASSQKSITTPEGSFEPNKSGENSRLNTNVVPHLNIPSKI
RPSECETLGSSLGHNVDLLNQNNALAKKKPYKCNKCRKAFIHRSSLNKHEKTHKGDTLPN
GTDPGVYPGKKHHECTDCGKTFLWKTQLTEHQRIHTGEKPFECNVCGKAFRHSSSLGQHE
NAHTGEKPYQCSLCGKAFQRSSSLVQHQRIHTGEKPYRCNLCGRSFRHGTSLTQHEVTHS
GEKPFQCKECGKAFSRCSSLVQHERTHTGEKPFECSICGRAFGQSPSLYKHMRIHKRGKP
YQSSNFSVDFKHSSSQDENTLTEVKTYHCDDCGEDFSHITDFTNHQKIHAGENPYDCEQA
FSQQSISHPGEKPYHCNVCGKAFKRSTSFIEHHRIHTGEKPYECNECGEAFSRRSSLTQH
ERTHTGEKPYECIDCGKAFSQSSSLIQHERTHTGEKPYECNECGRAFRKKTNLHDHQRIH
TGEKPYACKECGKNFSRSSALTKHQRIHARNKL
Download sequence
Identical sequences ENSDORP00000009673 ENSDORP00000009673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]