SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009719 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009719
Domain Number 1 Region: 459-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.06e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 2 Region: 420-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000462
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 3 Region: 504-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000123
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 257-360
Classification Level Classification E-value
Superfamily SET domain 0.00000687
Family Viral histone H3 Lysine 27 Methyltransferase 0.077
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009719
Domain Number - Region: 389-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000182
Family Classic zinc finger, C2H2 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009719   Gene: ENSDORG00000010341   Transcript: ENSDORT00000010340
Sequence length 560
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3803:364:13962:-1 gene:ENSDORG00000010341 transcript:ENSDORT00000010340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQQPAEAELQDKACYPLERFQSTPHHLAAYYASFPSYGHYGNALPSSEESLQPFPQTE
SSVAATQATAPFPFRMAPPLLSPELALQSEPFYNLPWYSKLSTWYPIPPLPREAPPCPNS
TECTGDISHDLVSFGGLSNSGQCWGPETFFLPPSVVASLLPEGLKSSQPISASKALNQDK
LPGPRFQFTQEELHFVLYGVTPNPEPQVRLHHAISGFPVPTESSGPSHLPQTLDKDSLQL
PEGLCIMQAMVGSIPHLGVFCSNFIAKGIRFGPFRGKVVNASEVKTHRDNSLMWEIFEDG
HLSHFIDGKGTGHWMSYVNCARFPKEQNLMAVQHQGQIFYESCKEVYQNQELLVWYGNCY
EKFLDIPMSLQAPEQGNQPAGQSDESAEGYRCERCGKVFTYRYYRDKHLKYTPCVDRGDR
KFPCSLCKRSFEKRDRLRIHVLHVHEKHRPYCSICGKCFSQSSSLNKHMRVHSGDRPYQC
VYCTKKFTASSILRTHIRQHSGEKPFKCKYCGKPFASHAAHDSHVRRSHKDDQSGTCSLC
GKSFPDQEAFYTHLKFHGDY
Download sequence
Identical sequences ENSDORP00000009719 ENSDORP00000009719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]