SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009768 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009768
Domain Number 1 Region: 114-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000178
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 165-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000546
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 457-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000261
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009768   Gene: ENSDORG00000010394   Transcript: ENSDORT00000010394
Sequence length 516
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6082:9466:72683:1 gene:ENSDORG00000010394 transcript:ENSDORT00000010394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDADEGQDMSQVSGKESPPVSDTPDDGDEPMPVPEDLSTTSGGQQNSKSDRGMASNIKVE
AQSDEENTRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGLGIRLPNKLKCDIC
GIICIGPNVLMXXXXXXXXERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYAC
RRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLQGTLYPVIKE
ETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKCLSDMAYDSSASYEKE
NEMMTSHVMDQAINNAINYLGAESLRPLVQTPPGGSEGVPVISPMYQLHKTPTEGPPRAN
HSAQDSAVENLLLLSKAKSASSEREASPSNSCQDSTDTESNTEEQQRGLIYLTHIAPLAR
NGLALKEEQRAFEVLRSASENSQDALRVVSMSGEQMKVYKCEHCRVLFLDHVMYTIHMGC
HGFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS
Download sequence
Identical sequences ENSDORP00000009768 ENSDORP00000009768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]