SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009787 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009787
Domain Number 1 Region: 721-776
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000305
Family Classic zinc finger, C2H2 0.05
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009787
Domain Number - Region: 1121-1149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000235
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 1167-1191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000808
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 769-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00199
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 1439-1463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00516
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number - Region: 1301-1342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00517
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 951-978
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00531
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 567-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0159
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 1401-1428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0184
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 1354-1382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0613
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009787   Gene: ENSDORG00000010416   Transcript: ENSDORT00000010415
Sequence length 1899
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2063:16754:77737:1 gene:ENSDORG00000010416 transcript:ENSDORT00000010415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGKGDAATAAEAEAKAPAGAGTGDGAETESMARGHRPTSPAPGAPGLRPCLWQLETEL
REQEVSEVSSLNYCRSFCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSCFELLLSVSESELPCEVWVPFLQSLQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXNKLIAQEGPSFLQMRIKHLLKSNCIYQATSLSKLCAE
SKEIAHVSSFQQAYITCLCSMLPSEDAIKEIAKVDCKEILDIICNLESEGQDNTAFVLCT
TYLTQQLQTASVYCSWELTLFWSKLQRRIDASLDTFLERCRQFGVIAKTQQHLFCLIRVI
QTEAQDAGGVSILLCVRAQLRSSEDEEMKASVCKTISCLLPEDLEVRRACQLTEFLIEPS
LDGFNMLEELYLQPDQKFDEENAPVPNSLRCELLLALKAHWPFDPEFWDWKTLKRHCHQL
LGQEASDSDDDLSGFEMSINDTDVLESFFSDYDEGKEDKQYRRRDLTDQHKEKRDKKPIG
SSERYQRWLQYKFFCLLCKRECIEARILHHSKMHMEDGIYTCPVCIRKFKRKEIFVPHVM
EHVKMPPSRRDRSRKKLLLKGSQKSICPKSPSSTLEQNQSLSEEAKGESHEYVTFSKLED
CHLQDRDLYPCPGTDCSRVFKQFKYLSVHLKAEHQNNDENAKHYLDMKNRREKCTYCRRH
FMSAFHLREHEQVHCGPQPYMCVSIDCYARFGSVNELLNHKQKHDDLRYKCELNGCNIVF
SDLGQLYHHEAQHFRDASYTCNFLGCKKFYYSKIEYQKHLSMHNVENSGGDMKKSVKLEX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXEKVFVSSSLKEKCSNMAVCFDGTKFTCGFDGCG
STYKNARGMQKHLRKVHPYHFKPKKIKTKDFFPCLSNQTTDKFDTEPKPCSDTNSDSPDE
GLDQNVHTKCKREHQGYSSEASICASKRPCTEDTMLELLLRLKHLSLKNSIAHGSFSGSL
QGYPSSGAKSLQSVSSTISDLNFQNQEENMPSQYLAQLAAKPFFCELQGCKYEFVTREAL
LMHYLKKHNYSKEKVLQLTMFQHRYSPFRCHICQRSFTRKTHLRIHYKNKHQIGSDRATH
KLLDSEKCDHEGPCSVDILKDDCSAELGGDPSSNSEKAQCHSKNECSSETDLESSCEETE
SKTSDISSPIGSHREGEGREGRGSRRTVAKGNLCYILNKYHKPFHCIHKTCNSSFTNLKG
LIRHYRTVHQYNKEQLCLEKDKARTKRELVKCKKIFACKYKECNKRFLCSKALAKHCSDS
HNLDHMEEPKILSEAESTARFSCNQPQCPAVFYTFSKLKHHLMEQHNIEGEIHSDYEIHC
DLNGCGQIFTHRSNYSQHVYYRHKDYYDDLFRSQKVANERLLRSEKVYQTAHTQMHEHQT
TRRSLNAKTKKCGLIKEKKAPITFKTRAEALHMCVEHSQHTQYPCMVQGCLSVVKLESSI
VRHYKRTHQMSSNYLEQQMENLVVCVKYGTKIKEEPLSEAEPCIKKEENTSCELEHTKHG
HSPGSSNAALQNTDSCHPGERNGAQKECTENPVFDADKLLYRGTLKCNHSSETTSLEQCN
IVQPLPCKIENSIPNPSGTESGTYFTSFQLPLPRIKEEPGQHSSIQENTVKNLTHVPKEN
FRKPSQSRSFDLKTYKPMGFESSFLKFIQESEEKEDDSDDWETSEHLTLSDSSQPSNDLV
GSIVANDPEVDIPHSSSDSAIHENLTAIPPLIVAETATVPSLENLRVVLDKALTDCGELA
LKQLHYLRPVVVLERSKFSAPILDLFPTKKTDELCVGSS
Download sequence
Identical sequences ENSDORP00000009787 ENSDORP00000009787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]