SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009806 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009806
Domain Number 1 Region: 376-435
Classification Level Classification E-value
Superfamily Leucine zipper domain 3.07e-17
Family Leucine zipper domain 0.0001
Further Details:      
 
Domain Number 2 Region: 11-39
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000039
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009806   Gene: ENSDORG00000010434   Transcript: ENSDORT00000010434
Sequence length 453
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3738:5589:223113:1 gene:ENSDORG00000010434 transcript:ENSDORT00000010434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPT
PTRFLKNCEEVGLFSELDCSFQHEFRKAQEEESSKRXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVPGSLSSLLHLHNRQRQPMPASMRG
TLPNPTMPGSSAVLMPMERQMSVNSSIMGLQGPNLSNPCASPQVQPMHSEAKMXXXXXXX
XXXXXXXXXXMNTMGHMMEMMGSRQAQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPSHHP
HPQPHHQQSHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQP
TGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEV
SMLKNEVAQLKQLLLTHKDCPITAMQKESQGYL
Download sequence
Identical sequences ENSDORP00000009806 ENSDORP00000009806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]