SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009863 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009863
Domain Number 1 Region: 10-148
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-37
Family Ankyrin repeat 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009863   Gene: ENSDORG00000010493   Transcript: ENSDORT00000010493
Sequence length 161
Comment pep:novel scaffold:dipOrd1:scaffold_10384:35200:45094:-1 gene:ENSDORG00000010493 transcript:ENSDORT00000010493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQ
LLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLE
NGADPTIETDSGYNSMDLAVALGYRSQIESHLLKLLQNIKE
Download sequence
Identical sequences ENSDORP00000009863 ENSDORP00000009863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]