SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009883 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009883
Domain Number 1 Region: 6-84
Classification Level Classification E-value
Superfamily RING/U-box 2.08e-20
Family RING finger domain, C3HC4 0.0025
Further Details:      
 
Domain Number 2 Region: 88-146
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.04e-16
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009883   Gene: ENSDORG00000010516   Transcript: ENSDORT00000010516
Sequence length 304
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1808:10783:54230:1 gene:ENSDORG00000010516 transcript:ENSDORT00000010516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASSTKKMRDIATCPICMNLMTHPVSIKCGHNFCQLCIIEFFNRVRRIQQKLDCPLCR
GPFDKNSFRPNKELENMIEVIKEMEEIDQQMLCKEHGEKLHLFCEDEGQLICWRCERSQH
QGHATALLEEVYQSYKEKLQKAMVNLNQLQEECMKHKMFLTLQMDDWKEEINRKRQKIKS
DFKNLRSFLHEEEKSYIWKLEKEEEQMLKRMRDSKASLEQKSSELQSHILELEAKCQGSV
QNMLQGVKDALVRSSAVKLEEPENFFLEIHTMCNVSELYFDVKKTVKRYQVYQHSPLFLP
PPDE
Download sequence
Identical sequences ENSDORP00000009883 ENSDORP00000009883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]