SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009930 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009930
Domain Number 1 Region: 760-868
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-22
Family DBL homology domain (DH-domain) 0.00082
Further Details:      
 
Domain Number 2 Region: 575-631
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000329
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.016
Further Details:      
 
Domain Number 3 Region: 94-156
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000454
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009930   Gene: ENSDORG00000010566   Transcript: ENSDORT00000010566
Sequence length 869
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6750:7633:107442:1 gene:ENSDORG00000010566 transcript:ENSDORT00000010566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQLQETVMVSVCLCSEGYSPVTMDSGSVTYVDNMACRLARLLVTQADRLTACSHQTLLTP
FALSVGALPVLDEELVLALTQMELPRGWTVLGNSSLEVSLPRETVLHLAVRWGLTKLCRF
LLCLPGGVQALALPNEEGATPLDLASHGGHPILVEDIIXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALELESQPEEPPTMPSGAAET
EEETNSVFDRSPPEKEDAKCVESLVVQLNEYKDQDSQDLXXXXXXXXXXXXXXXXXXXXR
LSDMLNGGDEVYANCMAIDQVGDLDINYINIGGISAHTNPDPLESTVGTQNCKHVLIPDS
GPVVCPRGENRKTMASKEACKTSMSSSGSHTPNLNLAFGLHGFEQSHLKKRSSLDALVAD
SEGEVCPEQPHLCHAPVSQNSSGIRVPSGDELDSFEPDLNISRTESLSLSSNLQSKESLL
SGIRSRSYSCSSPKISLGKTRLVRDLTVCNSSEEQGVYSVPEPPGGKRIQEEEWDKYIIP
AKSETEKYKVSRTFSFLMNRMTSPRNKSKMKNKDTKDKEKMNRHQFVPGTFSGVQQCSAC
DKTLLGKESFHCSNCNANVHKACKDTVLPCTKKLQDKYSKNKSQTILGTSSVRDIPQPGT
PLHPSSSMPIGLPAGRKETTGQVHPLSRSVPSTTLESFRRSVTSLESEGDGSSWRSRSHS
DELFQSVGSSPSTDSFMMEDVVDSSLWSDLSSDTQDFEAESWSLVVDPSFCSRQEKDVIK
RQDVIFELMQTEMHHIQTLFIMSEIFRKGMKEELQLDHSTVDKIFPCLDELLEIHRHFFF
SMKERKQESCVGNDRNFVINRIGDILVQQ
Download sequence
Identical sequences ENSDORP00000009930 ENSDORP00000009930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]