SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009971 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000009971
Domain Number - Region: 197-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000894
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 151-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.053
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009971   Gene: ENSDORG00000010609   Transcript: ENSDORT00000010607
Sequence length 294
Comment pep:novel scaffold:dipOrd1:scaffold_4424:27931:28812:-1 gene:ENSDORG00000010609 transcript:ENSDORT00000010607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKHLKNHVKKIQRQQITAAHDQEITALEEINGSSSSITFENGNLNKDMEIETLSTSSDG
NKAVISEHVAELTQIPTDVPKDVTENIIENGSPNSLNNLSESLPQCENDYEDEENEIDYE
EDDYDLNPETSVLHKINGTVCHPKDVYATDQEGNFKCPALGCVRIFKRIGFLNTHARTTH
PTDLNVRQTVMKWSKGKCKFCQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNESFKLPFQ
LAQHTKSHRIFQAQCSFPECHELFEDLPLLYEHEAQHYLSKTPESSVQPSEAII
Download sequence
Identical sequences ENSDORP00000009971 ENSDORP00000009971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]