SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009994 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009994
Domain Number 1 Region: 188-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000596
Family Classic zinc finger, C2H2 0.061
Further Details:      
 
Domain Number 2 Region: 13-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000157
Family HkH motif-containing C2H2 finger 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009994   Gene: ENSDORG00000010632   Transcript: ENSDORT00000010632
Sequence length 336
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_969:128779:136800:-1 gene:ENSDORG00000010632 transcript:ENSDORT00000010632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVQKAVLSHTFGGPLLKTKRPVISCNVCQIRFNSQSQAEAHYKGNRHARRVKGIEAAK
TRGREPGVREPGDPAPPGNTPPSGDGVTPRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKHKTIL
EARSGLGPIKAYPRLGPPTPGEPEAPAQDRTFHCEICNVKVNSEVQLKQHISSRRHRDGV
AGKPNPLLSRHKKPRGAGELAGTLTFSKELPKSLAGGLLPSPLAVAAVMAAAAGSPLSLR
PAPAAPLLQGPPITHPLLHPAPGPIRTAHGPILFPL
Download sequence
Identical sequences ENSDORP00000009994 ENSDORP00000009994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]