SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010022 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010022
Domain Number 1 Region: 6-94
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.57e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010022   Gene: ENSDORG00000010660   Transcript: ENSDORT00000010660
Sequence length 377
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1170:13887:26828:1 gene:ENSDORG00000010660 transcript:ENSDORT00000010660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVSYGIWICLECSGRHRGLGVHLSFVR
SVTMDKWKDIELEKMKAGGNAKFREFLEAQEDYDPDWSLQDKYNSRAAALFRDKVATLAE
GREWSLESSPAQNWTPPQPKMLSSTAHRPTGQSQHVSASGDKAFEDWLNDDLKSYQGAQE
NRYVGFGNTVPPQKREDDFLNNAMSSLYSGWSSFTTGASKFASAAKEGXXXXXXXXXXXF
WGYKQQPEPASELGHSLNENVLKPAQEXXXXXXXXXXXXXXXXXXXXGVGSKGWRDVTTF
FAGKADDPLDRPLEGQSYQNSGGDGFQNSAIDQSFWETFGSTEPMKTKSPSSESWTCADA
SAGRRSSDSWEVWGSGS
Download sequence
Identical sequences ENSDORP00000010022 ENSDORP00000010022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]