SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010090 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010090
Domain Number 1 Region: 21-102
Classification Level Classification E-value
Superfamily RING/U-box 5.52e-21
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 2 Region: 116-179
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000153
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010090   Gene: ENSDORG00000010737   Transcript: ENSDORT00000010737
Sequence length 335
Comment pep:novel scaffold:dipOrd1:scaffold_10694:41964:45899:1 gene:ENSDORG00000010737 transcript:ENSDORT00000010737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIGPWISPGGAGSEALALAAELQGEATCSICLELFREPVSVECGHSFCRACIARCWER
TGARPGRAASGPLPCPQCREPARPGQLRPNRPLAAMAALLRRFGPPPAPPARGTPETPAS
PCACALHGEQLKLFCQDDGRAICVVCDRAREHRAHAVLPLDEAVQDGKELLDSRLKVLKK
ELDDCEVFRSTEEKEGKELLMQMATEKEKVGAEFQALRAFLVEQEGRLLGRLEDLSREVT
QKQNENLAQLGAEITQLSKLSSQIQETAQKPDLDFLQEFKTTLSKCSNVPGPKPTTVSSE
MKNKVWNVSLKTFVLKGLLKKFKDDLQGELEKEEK
Download sequence
Identical sequences ENSDORP00000010090 ENSDORP00000010090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]