SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010094 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010094
Domain Number 1 Region: 786-856
Classification Level Classification E-value
Superfamily Homeodomain-like 2.01e-17
Family Homeodomain 0.0053
Further Details:      
 
Domain Number 2 Region: 130-154,184-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000206
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 3 Region: 554-596
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000244
Family Homeodomain 0.01
Further Details:      
 
Domain Number 4 Region: 1416-1464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000498
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010094
Domain Number - Region: 614-634,706-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000126
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number - Region: 1388-1414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.087
Family C2HC finger 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010094   Gene: ENSDORG00000010741   Transcript: ENSDORT00000010741
Sequence length 1512
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3057:26905:36106:-1 gene:ENSDORG00000010741 transcript:ENSDORT00000010741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTEAVICLGIDWEPSLNTDLCLLHLLLFPVEGPNLTPEASPDPVPEPPLPSVEAPDKPSE
SLDQPSSPAPSPGLQPDAQAEEVAPPPATMEEEEVGEPRSAEPAPADSRHPLTYRKTTNF
ALDKFLDPARPYKCTVCKESFTQKNILLVHYNSVSHLHKMKKAAIDPSGPARGEAGAPPT
TTAATDKPFKCTVCRVSYNQSSTLEIHMRSVLHQTRSRGTKSDAKADGPERSQEEPKEGE
TEGEVGTEKKGPDSSGFISGLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXFETSAYPKDGEVERLASLLGLASRVVVVWFQNARQKARKNASEGGP
VPAGGGTQSGGSGCRRCHITFSCVFELVRHLKKCYDDQTPEEEEEEAERGEEEEEVEEEE
VEEEQRLEPPTGPDGPSPEPPDVEELSQVEAIKPGDKEREGKAPPSPSTAYTCDQCAMAF
PSQDLLSSHRQLHFLPSVQPSAPPQLLDLPLLVLGERNSLVAGNPPVPGPPLKRKHEDGS
LSPTGSETGGGGEGEPPRDKRLRTTILPEQLEILYRWYMQDSNPTRKMLDCISEEVGLKK
RVVQVWFQNTRARERKGQFRSAPGGVGSPAVKATVTPTPAPFPKFNLLLGKIDEGTGREV
PKREPPVFPYPTVTPAAGPLPFLPPGKETTTPTPEPPLPPPPPPIEDEGPEEPSKASPES
EACSPSAGDLSDSSVSSLAEPESPGAGGSSGGLGGGTGVPDGMGQRRYRTQMSSLQLKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAASSGLLGLATS
VLPATTVVQTAGPGLPLPQRPVPDQTNNSTAGTTDPVPGPATEPSGNKVSSERKPGAAPP
SSSSDALKNLKALKATVPALLGGQFLPFPLPPAGGAAPPAVFGPQLQGAYFQQLYGMKKG
LFPMNPVIPQTLIGLLPNTLLQPPSQAPEPTATAPPNPPELPAPGEGEAGEADELLTGST
GISTVDVTHRYLCRQCKMSFDGEAPATAHQRSFCFFGRGSGGPMPPPLRVPICTYHCLAC
EVLLSGREALASHLRSSAHRRKAAPPPGGPSITVTNAATAATAAVAFAKEEARLPHTDSN
PKTTTTSTLLAL
Download sequence
Identical sequences ENSDORP00000010094 ENSDORP00000010094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]